PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17092_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 606aa    MW: 67715 Da    PI: 5.3677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17092_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.8e-193783148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  cra_locus_17092_iso_1_len_2142_ver_3 37 KGQWTPEEDEILRQAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                                          799****************************9.************986 PP

2Myb_DNA-binding63.34.6e-2089135148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           +g+W+ +Ede+++++v+++G++ W+tIa++++ gR +kqc++rw+++l
  cra_locus_17092_iso_1_len_2142_ver_3  89 KGPWSRQEDEKIIELVNKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                                           79******************************.*************97 PP

3Myb_DNA-binding49.11.3e-15141183145
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                           + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
  cra_locus_17092_iso_1_len_2142_ver_3 141 KEAWTQEEELALIRAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 183
                                           579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4913283IPR017930Myb domain
SuperFamilySSF466892.66E-173593IPR009057Homeodomain-like
SMARTSM007177.8E-163685IPR001005SANT/Myb domain
PfamPF002497.6E-173783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-233891IPR009057Homeodomain-like
CDDcd001678.07E-154083No hitNo description
PROSITE profilePS5129432.99984139IPR017930Myb domain
SuperFamilySSF466892.02E-3186182IPR009057Homeodomain-like
SMARTSM007177.4E-1988137IPR001005SANT/Myb domain
PfamPF002491.1E-1889135IPR001005SANT/Myb domain
CDDcd001677.80E-1791135No hitNo description
Gene3DG3DSA:1.10.10.607.5E-2892139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21140190IPR009057Homeodomain-like
PROSITE profilePS5129419.513140190IPR017930Myb domain
SMARTSM007176.3E-15140188IPR001005SANT/Myb domain
PfamPF002491.1E-13141184IPR001005SANT/Myb domain
CDDcd001675.42E-12143183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MESDRTSTTR SDTVSDNIQR VRPLHGRTSG PTRRSTKGQW TPEEDEILRQ AVQRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPDLVKG PWSRQEDEKI IELVNKYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPNIN KEAWTQEEEL ALIRAHQIYG NKWAELTKFL PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLA QFQGLPNAIH PNQSVAASSS KTQQSSEDDS APRDGVEEVS  240
ECSQSSAVVG CSNSTCDLVN TSAHAKDECL GHSSAHEWGS TVDKDWQLNQ TEIAEMASLD  300
FARETTGQFV HSSSGQFMHS LTHSEDHKLV PFQLQTSMGL SNAPSMLSMV LGTENPDHLF  360
ASENGCSTLL YPETRAEGPF PSGNNVIDGS ANTVLYQSSN YQIPEDGHLA SQSCHPLKPE  420
MLEATSFCEP FAVSSQLPVD DESLIFGIDP NLFNDSLVLQ SEQERFANKQ DGFIYSNDAG  480
SSPSNNAING SGMEQQLDRG NDSMRLVRVN DFDMSPPKNV HTNPAAEENT PVSHKQKDSG  540
TLFYEPPRFP SLDIPFFSCD LIQSSTDMQQ EYSPLGIRQL MMSSINCTPF RLWDSPKRDD  600
SPDAVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C6e-69371906159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-69371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009595014.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G71e-159MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A068V5X20.0A0A068V5X2_COFCA; Uncharacterized protein
STRINGSolyc08g068320.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31072448